DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and MMS21

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_010896.3 Gene:MMS21 / 856695 SGDID:S000000745 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:43/244 - (17%)
Similarity:95/244 - (38%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAMKHAKNSSNTIEKFEEVW 82
            |:.:|::.|.::...|...     ...:.:.|.:..:.|.::|||.....:.:....|:..::.:
Yeast    35 QQCYKQIDETINQLVDSTS-----PSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNF 94

  Fly    83 KERSEAVEQKRIDVKNSAEFKN-----------FMKAAAPQAGAETNG----------------- 119
            |:.|:|..|  ||:....:::.           ::....|:.....|.                 
Yeast    95 KQSSDACPQ--IDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDP 157

  Fly   120 -----QANSAAHDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGI 179
                 ...:.|.::||.:|  ||:: .|..|.:....:.|:.::||.|::|||.:...:......
Yeast   158 TCVIPDLQNPADEDDLQIE--GGKI-ELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTR 219

  Fly   180 RCPVLGCPNRSYIHPAHLVKDSNLQQKLQERMSDAIEKETSSEEDDEQA 228
            .||...|  ...:.....|:|..::.:.:      |.|...|:|.|:::
Yeast   220 DCPQAAC--SQVVSMRDFVRDPIMELRCK------IAKMKESQEQDKRS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 16/57 (28%)
MMS21NP_010896.3 COG5627 1..267 CDD:227914 43/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.