DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and nsmce2

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001122190.1 Gene:nsmce2 / 564644 ZFINID:ZDB-GENE-081022-128 Length:230 Species:Danio rerio


Alignment Length:217 Identity:53/217 - (24%)
Similarity:101/217 - (46%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LENQKFFKEMAEVVSDFSDGREIQKLLDQNVD-LAENLIRMKSK-HQLLSKAMKHAKNSSNTIEK 77
            :||....|::.|::.:.|       .||..:: |.|::..|.:: .....:||.:.:.|..  ::
Zfish    40 MENSPSLKKLGEMIMECS-------RLDSEINCLVESVNEMTAQVRHAPPEAMVNLRGSVK--DR 95

  Fly    78 FEEVWKERSEAVEQKRIDVKNSAE---FKNFMKAAAPQAGAETNGQANSAAHDEDLIME--ATGG 137
            |.|:....|::      |::|.::   ||..::..|.||       .|.|.::|:.:.|  |...
Zfish    96 FTELIAGVSDS------DLRNHSKVVAFKETVRKYAMQA-------QNPAENEEEELDEDIAVTQ 147

  Fly   138 EVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLII----TDNIGIRCPVLGCPNRSYIHPAHLV 198
            ...:...|.::..:.||::||||.|.||:::|:.:|    .:....|||.:||.|..       |
Zfish   148 SQTNFICPLTQVEMVNPMKNKKCNHYYDQEAVLEMIKNKHKNRKKFRCPKVGCGNAD-------V 205

  Fly   199 KDSNLQQKL--------QERMS 212
            ::|:|:..|        |:|.|
Zfish   206 QESDLELDLIMKRMIQNQKRQS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 18/63 (29%)
nsmce2NP_001122190.1 RING 143..201 CDD:302633 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12368
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5462
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5680
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.