DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and qjt

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001261988.1 Gene:qjt / 39952 FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster


Alignment Length:233 Identity:161/233 - (69%)
Similarity:190/233 - (81%) Gaps:7/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFNYHVDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDL----AENLIRMKSKHQLL 61
            |:|||..||||:||:||:||||||::.|||||||.:|:|||:|:|:.    |.|::.||.|||.|
  Fly     1 MEFNYLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVEHAVNVVHMKIKHQSL 65

  Fly    62 SKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSAEFKNFMKA---AAPQAGAETNGQANS 123
            :|||...||||.|||:|||||||||:|||||||:|||..|||||:||   ||.|||||.|.|||.
  Fly    66 NKAMNQVKNSSATIEEFEEVWKERSKAVEQKRINVKNLHEFKNFVKAVESAAGQAGAEVNDQANG 130

  Fly   124 AAHDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGCPN 188
            .|:|||||||.:|.||||.||||||||||||:|||.|||||||||||.||.|.||||||||||.|
  Fly   131 TAYDEDLIMEDSGSEVFSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCAN 195

  Fly   189 RSYIHPAHLVKDSNLQQKLQERMSDAIEKETSSEEDDE 226
            ..||.|.|||:|:|:|||:|:.||:||...|:||||:|
  Fly   196 LCYIQPDHLVQDANVQQKIQQSMSNAIVDVTASEEDEE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 48/57 (84%)
qjtNP_001261988.1 RING 135..194 CDD:302633 49/58 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440825
Domainoid 1 1.000 43 1.000 Domainoid score I12368
eggNOG 1 0.900 - - E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2626
Isobase 1 0.950 - 0 Normalized mean entropy S7995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103906at33392
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 1 1.000 - - mtm9672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5680
SonicParanoid 1 1.000 - - X2979
1211.880

Return to query results.
Submit another query.