DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and Nsmce2

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_017450247.1 Gene:Nsmce2 / 299957 RGDID:1305156 Length:273 Species:Rattus norvegicus


Alignment Length:277 Identity:60/277 - (21%)
Similarity:103/277 - (37%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAM------ 65
            |:|||::|...|.......:.||..:            :||.|....:.|::. :.|||      
  Rat    20 VESALSSLKTFQSCISSGMDTVSSVA------------LDLVETQTEVSSEYS-MDKAMVEFAKM 71

  Fly    66 -----KHAKNSSNTIEKFEEVWKERSEAVEQKRIDV---------KNS-AEFKNFMKAAA----- 110
                 .:.|...:||...:|   ||.|.|...::.|         ||| |:||...|...     
  Rat    72 DRELNHYVKAVQSTINHVKE---ERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQL 133

  Fly   111 --------------------PQAGAETNGQANSAAH-----------DEDLIMEATGGEVFSLYD 144
                                |...:...|......|           |||:|:..:......   
  Rat   134 RELKKQLVKPREDGRHNEFDPNKDSSRTGNERDGIHADRENDGIEGMDEDMIVTQSQTNFIC--- 195

  Fly   145 PWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIR----CPVLGCPNRSYIHPAHLVKDSNLQQ 205
            |.::..:|.||:||.|||.|:.::::.:|......:    ||.:|| :.:.:..:.|:.|..|::
  Rat   196 PITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGC-SHTDMRMSDLIPDEALRR 259

  Fly   206 KLQERMSDAIEKETSSE 222
            .::   |...:|:..||
  Rat   260 AIE---SHNKKKKRHSE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 16/61 (26%)
Nsmce2XP_017450247.1 zf-Nse 182..242 CDD:288622 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12168
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.