DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and NSMCE2

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_016868819.1 Gene:NSMCE2 / 286053 HGNCID:26513 Length:249 Species:Homo sapiens


Alignment Length:234 Identity:61/234 - (26%)
Similarity:105/234 - (44%) Gaps:54/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFNYHVDS-ALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKA 64
            |..|.::|. ||...:   ||....|||.|::|..:.:       |:.|           .|.:.
Human    33 MTSNVNLDHLALVVFV---KFLYWKAEVSSEYSMDKAM-------VEFA-----------TLDRQ 76

  Fly    65 MKH-AKNSSNTIEKFEEVWKERSE-------AVEQK--RIDVKNS----------AEFKNFMKAA 109
            :.| .|...:||...:|   ||.|       .||:|  .:..|||          .:||..:|..
Human    77 LNHYVKAVQSTINHVKE---ERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKEL 138

  Fly   110 APQAGAETNGQAN-SAAHDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLII 173
            ..|.|.:.:.:|: :...|||:|:  |..:. :...|.:|..:|.||:||.|||.|:.|:::.:|
Human   139 KKQCGLQADREADGTEGVDEDIIV--TQSQT-NFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMI 200

  Fly   174 TDNIGIR----CPVLGCPNRSYIHPAHLVKDSNLQQKLQ 208
            ......:    ||.:|| :.:.|..:.|::|..|::.::
Human   201 ESRQKRKKKAYCPQIGC-SHTDIRKSDLIQDEALRRAIE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 19/61 (31%)
NSMCE2XP_016868819.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12292
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5364
Isobase 1 0.950 - 0 Normalized mean entropy S7995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5680
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.