DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and ZK1248.11

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001380006.1 Gene:ZK1248.11 / 173987 WormBaseID:WBGene00022881 Length:201 Species:Caenorhabditis elegans


Alignment Length:191 Identity:45/191 - (23%)
Similarity:84/191 - (43%) Gaps:47/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HVDS--ALTTLLENQKF----FKEMAEVVSDFSDGREIQKLLDQ-NVDL---AENLIRMKSKHQL 60
            |::|  |::..:::::|    .|:..:::...::|.::|.:.:. :.||   ::.:...|:..:|
 Worm    25 HINSKNAISNEVDSEEFKETLMKDAMKLMELETEGAQMQHIFEALHNDLKDGSDEVPNEKALEEL 89

  Fly    61 LSKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSAEFKNFMKAAAPQAGAETNGQANSAA 125
            ..||.|..||.....:.|:::       ::..|.:.||.   :|.|:....|             
 Worm    90 YEKAKKTHKNVKGERQYFKDI-------IKSIRDESKND---ENEMEVMQVQ------------- 131

  Fly   126 HDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGC 186
                          .|..||.||..|.|||.:|.|||:|||||:.........|:|.:.||
 Worm   132 --------------HSRKDPISKKDIVNPVISKNCGHVYDRDSIHEFAGKKRVIKCAMQGC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 20/57 (35%)
ZK1248.11NP_001380006.1 SPL-RING_NSE2 134..199 CDD:319565 21/45 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8246
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 1 1.000 - - oto20024
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.