DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HPN and CG16749

DIOPT Version :10

Sequence 1:NP_002142.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:123/269 - (45%) Gaps:70/269 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   162 RIVGGRDTSLGRWPWQVSLR-YDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQA 225
            |:|.|.|:|:.::|:.:|:| ..|:|.||||::|..:|:|||||...|               :|
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR---------------KA 78

Human   226 SPHGLQLG-------------VQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEY----I 273
            |...:|.|             |:.::.|..|.|:.:     .:|||:|:.:..|.   |:    :
  Fly    79 SDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNN-----YANDISLLLVEEPF---EFDGVTV 135

Human   274 QPVCLP----------AAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFY 328
            .||.||          |.|:.:       :.|||.....|.....|||..:.:.|::.|  .:.:
  Fly   136 APVKLPELAFATPQTDAGGEGV-------LIGWGLNATGGYIQSTLQEVELKVYSDEEC--TERH 191

Human   329 GNQIKPKM-FCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWG-TGCALAQKPGVYT 391
            |.:..|:. .|.|..|||...|.||||||.:...        :..|||||. ..|.:|..||||.
  Fly   192 GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNG--------QQVGIVSWSIKPCTVAPYPGVYC 248

Human   392 KVSDFREWI 400
            |||.:.:||
  Fly   249 KVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HPNNP_002142.1 Hepsin-SRCR 51..159 CDD:462736
Tryp_SPc 163..400 CDD:238113 78/266 (29%)
CG16749NP_649881.1 Tryp_SPc 30..259 CDD:238113 80/268 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.