DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15643 and AT3G59390

DIOPT Version :9

Sequence 1:NP_001285276.1 Gene:CG15643 / 32489 FlyBaseID:FBgn0030654 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_191498.2 Gene:AT3G59390 / 825108 AraportID:AT3G59390 Length:273 Species:Arabidopsis thaliana


Alignment Length:193 Identity:64/193 - (33%)
Similarity:88/193 - (45%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVLVVLLLIYGFGHIFDRDSFSGLHYDEYVVQRTRPLLWTQQLLAPEEQLNRTRGD----PEARC 77
            ::.:|||||.||  :|                   ||           :::..|.|    .|..|
plant     8 LLFLVLLLIMGF--LF-------------------PL-----------RVSAIRKDIGFLEERSC 40

  Fly    78 RNSVQGRQWLADERGFVCRREEVLT----NGCCNLELPGIG-YYSCRTCNTSTHCCGVYEYCVSC 137
            |.:||||..::|:.|.||   :.|:    ..||    |..| .:||..||..:.||..||:||||
plant    41 RTTVQGRYLISDDEGNVC---DALSLESRTRCC----PWKGERFSCHGCNILSQCCNSYEFCVSC 98

  Fly   138 CLHPGQQPLLERVLQAPNTPKYIFASVTDHFELCLVKCRTNSHSVEHENKYRDPAAKHCYGLT 200
            ||:| .|.|||:|::..........:....|:.|..:||.||.||.|||.|.. ...||:.||
plant    99 CLNP-SQTLLEKVVKVKVAKPATSGTYKSVFDFCAGRCRHNSESVVHENAYHS-EFHHCFSLT 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15643NP_001285276.1 DUF2054 74..197 CDD:287222 49/127 (39%)
AT3G59390NP_191498.2 DUF2054 37..156 CDD:402015 49/127 (39%)
Glyco_transf_18 <179..272 CDD:405678
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2774
eggNOG 1 0.900 - - E1_KOG3136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602813at2759
OrthoFinder 1 1.000 - - FOG0007174
OrthoInspector 1 1.000 - - oto3159
orthoMCL 1 0.900 - - OOG6_106237
Panther 1 1.100 - - LDO PTHR13481
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5284
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.