DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15643 and Spring1

DIOPT Version :9

Sequence 1:NP_001285276.1 Gene:CG15643 / 32489 FlyBaseID:FBgn0030654 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001074705.1 Gene:Spring1 / 76792 MGIID:1924042 Length:205 Species:Mus musculus


Alignment Length:212 Identity:95/212 - (44%)
Similarity:126/212 - (59%) Gaps:16/212 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAL--TRLLRRRIVYIVLVVLLLIYGFGHIFDRDSFSGLHYDEYVVQ-RTRPLLWTQQLLAPEEQ 65
            |||  .||||:|.|..::..|.|:|.....|.::..:....:...|| |.:|:.|..|.    ..
Mouse     5 AALLWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVQDREQPIPWKVQF----NL 65

  Fly    66 LNRTRGDPEARCRNSVQGRQWLADERGFVCRREEVLTNGCCNLELPGIGYYSCRTCNTSTHCCGV 130
            .|.:|  |..:|||||||:..|.||.|:||.|:::|.||||::.:|....|.|..| .:..||..
Mouse    66 GNSSR--PSNQCRNSVQGKHLLTDELGYVCERKDLLANGCCDVSVPSTKQYCCDGC-LANGCCEA 127

  Fly   131 YEYCVSCCLHPGQQPLLERVL-QAPNTPKYIFASVTDHFELCLVKCRTNSHSVEHENKYRDPAAK 194
            |||||||||.|.:|.||||.| :|....:.:|.:|.|||||||.||||:|.||:|||.||||.||
Mouse   128 YEYCVSCCLQPSKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAK 192

  Fly   195 HCYGLTDAHESQRDVAP 211
            :|||     ||..::.|
Mouse   193 YCYG-----ESPPELFP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15643NP_001285276.1 DUF2054 74..197 CDD:287222 67/123 (54%)
Spring1NP_001074705.1 DUF2054 74..195 CDD:370892 67/121 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849508
Domainoid 1 1.000 151 1.000 Domainoid score I4368
eggNOG 1 0.900 - - E1_KOG3136
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32599
Inparanoid 1 1.050 165 1.000 Inparanoid score I4188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007174
OrthoInspector 1 1.000 - - oto93678
orthoMCL 1 0.900 - - OOG6_106237
Panther 1 1.100 - - LDO PTHR13481
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5724
SonicParanoid 1 1.000 - - X5284
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.