DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and si:ch211-256m1.8

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_001335682.4 Gene:si:ch211-256m1.8 / 795494 ZFINID:ZDB-GENE-131127-417 Length:1574 Species:Danio rerio


Alignment Length:317 Identity:110/317 - (34%)
Similarity:164/317 - (51%) Gaps:36/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPVLLIHGGAGDISDSRIAGKFAGIKQ-ALRSAWGLLSPDNGSGGGSALDAVEAAVRSMELDEN 65
            |...||||||||:  :..:..|...|.: ||::|. .|.....|.|||:||||:.:|.::|....
Zfish   633 PDFTLLIHGGAGE--EMMLNQKVVEIIEFALQTAL-TLGAQVLSHGGSSLDAVQKSVVALEDCFL 694

  Fly    66 FNAGYGSCLNTSGQVELEASLMEGRDLRAGCITLLRDVMHPITVARRLMEKQRHTFLGGAAAQEL 130
            ||||.||..|..|:.|:||::::|....:|.:..||:|.:||..||.:|||..|:.|.|..|:|.
Zfish   695 FNAGKGSVYNRDGEQEMEATIVDGHGKNSGSVACLRNVKNPIKAARCVMEKSVHSLLIGEGAEEF 759

  Fly   131 ALATGSERLQPGALVTEGARLTLKEFEDQVAQGKDPFFARTELTDDKPVPKTDPSGETVGAVAMD 195
            ..:.|.:.....|... |..|..||...:...||          ::.|        :||||||:|
Zfish   760 IESVGEKETTVKADYF-GTDLRFKELIMKSGDGK----------NNHP--------QTVGAVALD 805

  Fly   196 ASGQIVVGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEY 260
            ..|::...|||||:.|||.||:|||.|:|:|.|||. :..|:.:|.|:..:|..:|.::.|....
Zfish   806 KWGKLAAATSTGGLVGKWKGRVGDTAIVGAGIYADE-KLAVTCSGDGDVFLRQTVAHKVASLYNL 869

  Fly   261 QGLSAQAAADKECRE-----MTKRLGGTGGAIVVGHSGDLGISFTSRRMAWGYVQDG 312
            :|.|.:.|    |||     :.::   ..|.|.|.|.|:..|...:..|..|.:.:|
Zfish   870 KGYSLRQA----CREVIYNDLEEK---CAGIIAVDHHGEAVIETNAGVMFVGSMVNG 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 109/314 (35%)
ASRGL1_like 3..312 CDD:271338 108/314 (34%)
si:ch211-256m1.8XP_001335682.4 Carn_acyltransf 3..513 CDD:279140
Asparaginase_2 636..916 CDD:271337 108/309 (35%)
PRK10226 639..912 CDD:182319 104/302 (34%)
Hit 1088..1232 CDD:223611
PRK06462 1233..1566 CDD:235808
class_II_aaRS-like_core 1256..1566 CDD:294192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D520430at33208
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102189
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.