DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and zgc:153169

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001070234.2 Gene:zgc:153169 / 767799 ZFINID:ZDB-GENE-060929-764 Length:289 Species:Danio rerio


Alignment Length:258 Identity:84/258 - (32%)
Similarity:123/258 - (47%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GGSALDAVEAAVRSMELDENFN---AGYGSCLNTSGQVELEASLMEGRDLRAGCITLLRDVMHPI 107
            |.:|.|.||.|:..:|.|.:..   .|.|...|.:|.||.:|::|||...|.|.:..||.:..|.
Zfish    24 GQNATDVVETAMAEVEDDLDTGRHIVGRGGFPNATGVVECDAAIMEGLPRRFGAVAALRGIPQPC 88

  Fly   108 TVARRLMEKQRHTFLGGAAAQELALATGSERLQPGALVTEGARLTLKEFEDQVAQGKDPFFARTE 172
            .|||::||:..|:.|.|..|:..|...|... :|..          |...|..|.....|..:.|
Zfish    89 RVARKVMEESPHSLLVGEGAEAFAQDLGFTS-EPNE----------KMLSDHTASAYQEFLEKKE 142

  Fly   173 LTDDKPVPKTDPSGETVGAVAMDASGQIVVGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVS 237
                 ||   ....:|:|.:|:|.||.|.||.||.|...|.|||:||:|:.|.|.|||:..|..:
Zfish   143 -----PV---KGGHDTIGLIALDLSGNITVGVSTSGAPFKLPGRVGDSPLPGCGLYADHTVGAAA 199

  Fly   238 TTGHGETLMRYNLAQRILSAMEYQGLSAQAAADKECREMTKRLGGTG----GAIVVGHSGDLG 296
            .||.|:.:|.|..:..::..|: ||.|...|......::.:|:||..    |.|.:...|::|
Zfish   200 ATGDGDKIMCYCPSFHVVQLMK-QGSSPNEACSAVLADIQRRMGGNQCFEIGLISLNLKGEVG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 84/258 (33%)
ASRGL1_like 3..312 CDD:271338 84/258 (33%)
zgc:153169NP_001070234.2 Glycosylasparaginase 4..274 CDD:271335 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1943
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.