DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and CG4372

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster


Alignment Length:239 Identity:66/239 - (27%)
Similarity:107/239 - (44%) Gaps:35/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NTSGQVELEASLMEGRDLRAGCITLLRDVMHPITVARRLMEKQRHTFLGGAAAQELALATGSERL 139
            :|.|.:.|||::|:|..|..|.:..:..|.:.|.||..:::..:|:.|.|.:|.:.|.:.|   .
  Fly   106 DTEGALTLEAAIMDGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLG---Y 167

  Fly   140 QPGALVTEGARLTLKEFEDQVAQGKDPFFARTELTDDKPVPKTD-----PSGE------------ 187
            :...|.....|..||::.   :.|..|.|.|    |..|.|..:     |..|            
  Fly   168 KEEYLTDARTRNVLKKWR---SNGCQPNFWR----DVHPSPAENCGPYSPLPEHMHQHPMHQEYA 225

  Fly   188 -------TVGAVAMDASGQIVVGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETL 245
                   .:..:|:||.|:..|.:.:.|...:.|||:||:.:.|:|.||||..||...:|.|:.|
  Fly   226 IIQGQHDQLAFLALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVL 290

  Fly   246 MRYNLAQRILSAMEYQGLSAQAAADKECREMTKRLGGTGGAIVV 289
            ||:..|...:.||. .|.....||:...:.:.:......||:||
  Fly   291 MRHLPAFLAVEAMR-AGKEPDKAAELVVQRLLRHNTEFNGAVVV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 66/239 (28%)
ASRGL1_like 3..312 CDD:271338 66/239 (28%)
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.