DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and CG10474

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster


Alignment Length:322 Identity:100/322 - (31%)
Similarity:141/322 - (43%) Gaps:35/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QALRSAWGLLSPDNGSGGGSALDAVEAAVRSME-LDENFNAGYGSCLNTSGQVELEASLMEGRDL 92
            :|.:.||.||:...| |.|....||...:...| |......|||...:..|...|:|.||:|..:
  Fly    10 EAKKEAWRLLNVKKG-GLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDALLMDGGTM 73

  Fly    93 RAGCITLLRDVMHPITVARRLMEKQRHTFLGGAAAQELALATGSERLQPGALVTEGARLTLKEFE 157
            ..|.:..||.:...|.||:.::|...||.|.|..|.|.|.|.|   ||..:|.:|....:||.:.
  Fly    74 EVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMG---LQYESLNSEDNIESLKNWT 135

  Fly   158 DQVAQGK-------DPFFARTELTDDKPVPKTDPSG-------------ETVGAVAMDASGQIVV 202
            ....|..       ||   ||.....:|:...||:.             :|:...|:|..|.|.|
  Fly   136 RHNCQPNFWRNVHPDP---RTSCGPYQPLVTWDPNAKQSDRIEIGPDNHDTITMAAIDEEGHIHV 197

  Fly   203 GTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEYQGLSAQA 267
            ||||.|:....|||:||..|.||..||||..|...|||.|:.|||:..:...:.||. .|.:...
  Fly   198 GTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMR-AGKTPAE 261

  Fly   268 AADKECREMTKRLGGTGGAIVVGHSGDLGISFTSRRMAWGYVQD-GTIFYGIE--GQVVHQE 326
            |.:...:.:.|.:.....|::|.:.  || ::..|....|..:| |...|.:.  ||.|..|
  Fly   262 AVELVIQRIQKHVKYFEVAVIVANR--LG-TYAVRCHGTGMARDNGKFAYMVSSPGQPVRTE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 93/302 (31%)
ASRGL1_like 3..312 CDD:271338 94/304 (31%)
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 96/312 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.