DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and CG1827

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_610504.4 Gene:CG1827 / 35989 FlyBaseID:FBgn0033431 Length:393 Species:Drosophila melanogaster


Alignment Length:290 Identity:86/290 - (29%)
Similarity:123/290 - (42%) Gaps:37/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AWGLLSPDNGSGGGSALDAVEAAVRSMELDENFNAGYGSCLNTSGQVELEASLMEGRDLRAGCIT 98
            ||.:|....|....:....||...:..:|..:...|||...:..|:..|:|.:|:|..:..|.:.
  Fly    72 AWRILKQSKGGLRQTRNAVVEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVA 136

  Fly    99 LLRDVMHPITVARRLMEKQRHTFLGGAAAQELALATGSERLQPGALVTEGARLTLKEFEDQ---- 159
            .||.:...|.|||.::|..:||.|.|.||...|.|.|.|   ..:|||       .|.:|.    
  Fly   137 GLRRIKDAIKVARHVLEHTQHTMLVGDAASAFANAMGFE---SESLVT-------PESKDMWLQW 191

  Fly   160 VAQGKDPFFARTELTDDK---------PVPKT--------------DPSGETVGAVAMDASGQIV 201
            .|:...|.|.:....|.|         |.|.|              ..:.:|:|.:|:|....|.
  Fly   192 TAENCQPNFWKNVHPDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIH 256

  Fly   202 VGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEYQGLSAQ 266
            .||||.|...|.|||:||:||.|:|.||||..|....||.|:.:||:..:...:..|......|:
  Fly   257 AGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVETMRAGKPPAE 321

  Fly   267 AAADKECREMTKRLGGTGGAIVVGHSGDLG 296
            ||.:...|.:.......|..|.|...|:.|
  Fly   322 AAQEGLRRILKHHKDFMGALIAVDRLGNYG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 86/290 (30%)
ASRGL1_like 3..312 CDD:271338 86/290 (30%)
CG1827NP_610504.4 Glycosylasparaginase 58..366 CDD:271335 86/290 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.