DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7860 and AGA

DIOPT Version :9

Sequence 1:NP_001285275.1 Gene:CG7860 / 32488 FlyBaseID:FBgn0030653 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_000018.2 Gene:AGA / 175 HGNCID:318 Length:346 Species:Homo sapiens


Alignment Length:294 Identity:89/294 - (30%)
Similarity:139/294 - (47%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KQALRSAWGLLSPDNGSGGGSALDAVEAAVRSMELDE-NFNAGYGSCLNTSGQVELEASLMEGRD 91
            |.|..:||..|     :.|||||||||:.....|.:: :.:.|:|...:..|:..|:|.:|:|..
Human    37 KNATEAAWRAL-----ASGGSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTT 96

  Fly    92 LRAGCITLLRDVMHPITVARRLMEKQRHTFLGGAAAQELALATGSERLQPGALVTEGARLTLKE- 155
            :..|.:..||.:.:.|.|||:::|...||.|.|.:|...|.:.|        .:.|....|..: 
Human    97 MDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMG--------FINEDLSTTASQA 153

  Fly   156 -FEDQVAQGKDPFFARTELTD----------------DKPVPK---TDPSGETVGAVAMDASGQI 200
             ..|.:|:...|.:.|..:.|                |.|:.|   .|...:|:|.|.:..:|.|
Human   154 LHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHI 218

  Fly   201 VVGTSTGGITGKWPGRIGDTPILGSGTYADNCRGGVSTTGHGETLMRYNLAQRILSAMEY--QGL 263
            ..||||.||..|..||:||:||.|:|.|||:..|..:.||:|:.|||:..:.:   |:||  :|.
Human   219 AAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQ---AVEYMRRGE 280

  Fly   264 SAQAAADKECREMTKRLGGTGGAIVVGH-SGDLG 296
            ....|..|....:.|......||::..: :|..|
Human   281 DPTIACQKVISRIQKHFPEFFGAVICANVTGSYG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7860NP_001285275.1 PRK10226 1..311 CDD:182319 89/294 (30%)
ASRGL1_like 3..312 CDD:271338 89/294 (30%)
AGANP_000018.2 Glycosylasparaginase 29..332 CDD:271335 89/294 (30%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 234..237 1/2 (50%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 257..260 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.