DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and HPY2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_188133.2 Gene:HPY2 / 820746 AraportID:AT3G15150 Length:249 Species:Arabidopsis thaliana


Alignment Length:199 Identity:49/199 - (24%)
Similarity:81/199 - (40%) Gaps:43/199 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLEDT-NYMNAVES 75
            |...:||::...||      ..:.|..|:.    ...|.:.|||: .|....|:|. ..:.|..|
plant    58 LENSVAELLDLHSD------CNHRSTAIQS----VANRYQPVEQL-TDFKKLLDDEFTKLKATPS 111

  Fly    76 -------------EAQKNI--AGL------DEDLIMEDFGVEVVPFHDPWSKLLIKH---PVRNK 116
                         ||..|:  ||.      |||::|......::....|.|...:..   |||:.
plant   112 SVPQNDHLMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSM 176

  Fly   117 RCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEH--LVKDPDVEQELQKRKS-DKIKNETS 178
            .|.|:|::..:|..|.:|....|||..|..    ||::  ::.|..::.|:::.:| :|..|...
plant   177 DCRHVYEKSVILHYIVNNPNANCPVAGCRG----KLQNSKVICDAMLKFEIEEMRSLNKQSNRAE 237

  Fly   179 SDED 182
            ..||
plant   238 VIED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 17/60 (28%)
HPY2NP_188133.2 SPL-RING_NSE2 157..225 CDD:319565 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2626
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.