DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and CG42300

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_727865.2 Gene:CG42300 / 7354426 FlyBaseID:FBgn0259196 Length:181 Species:Drosophila melanogaster


Alignment Length:182 Identity:179/182 - (98%)
Similarity:181/182 - (99%) Gaps:1/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKMDPKSHQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLE 65
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLE 65

  Fly    66 DTNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMI 130
            ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 DTN-MNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMI 129

  Fly   131 IKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIKNETSSDED 182
            |||||||||||||||||||||||||||||||||||||||||||:||||||||
  Fly   130 IKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIQNETSSDED 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 57/57 (100%)
CG42300NP_727865.2 RING 85..143 CDD:302633 57/57 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471856
Domainoid 1 1.000 43 1.000 Domainoid score I12368
eggNOG 1 0.900 - - E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2626
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 1 1.000 - - mtm9672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
109.900

Return to query results.
Submit another query.