DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and nsmce2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001122190.1 Gene:nsmce2 / 564644 ZFINID:ZDB-GENE-081022-128 Length:230 Species:Danio rerio


Alignment Length:172 Identity:45/172 - (26%)
Similarity:71/172 - (41%) Gaps:50/172 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLEDTNYMNAVESEA 77
            |.|:...||:|.       .:|.|..:...|.|.|...:|                 .|..|:|.
Zfish    96 FTELIAGVSDSD-------LRNHSKVVAFKETVRKYAMQA-----------------QNPAENEE 136

  Fly    78 QKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMII----KDNIGIL 138
            ::    ||||:.:..   ....|..|.:::.:.:|::||:|.|.||:|.||.:|    |:.....
Zfish   137 EE----LDEDIAVTQ---SQTNFICPLTQVEMVNPMKNKKCNHYYDQEAVLEMIKNKHKNRKKFR 194

  Fly   139 CPVRDCPNLSDIKLEHLVKDPDVEQEL--------QKRKSDK 172
            ||...|.|..       |::.|:|.:|        |||:|.|
Zfish   195 CPKVGCGNAD-------VQESDLELDLIMKRMIQNQKRQSGK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 18/61 (30%)
nsmce2NP_001122190.1 RING 143..201 CDD:302633 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596353
Domainoid 1 1.000 43 1.000 Domainoid score I12368
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5462
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.