DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and cerv

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster


Alignment Length:208 Identity:114/208 - (54%)
Similarity:133/208 - (63%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HQKLFREMAEVVSNSSDDGE--KLL--------------------------TKNSSNTIEKSEEV 45
            :||.|:|||||||:.||..|  |||                          .|||||||||.|||
  Fly    17 NQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAMKHAKNSSNTIEKFEEV 81

  Fly    46 CKERPEAVEQMRIDVNNSLEDTNYMNA------VESEAQKNIAGLDEDLIMEDFGVEVVPFHDPW 104
            .|||.|||||.||||.||.|..|:|.|      .|:..|.|.|..|||||||..|.||...:|||
  Fly    82 WKERSEAVEQKRIDVKNSAEFKNFMKAAAPQAGAETNGQANSAAHDEDLIMEATGGEVFSLYDPW 146

  Fly   105 SKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            ||.|||:|||||:|||||||::|::||.|||||.|||..|||.|.|...|||||.:::|:||:|.
  Fly   147 SKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGCPNRSYIHPAHLVKDSNLQQKLQERM 211

  Fly   170 SDKIKNETSSDED 182
            ||.|:.||||:||
  Fly   212 SDAIEKETSSEED 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 40/57 (70%)
cervNP_001285278.1 RING 128..186 CDD:302633 40/57 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12368
eggNOG 1 0.900 - - E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2626
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103906at33392
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 1 1.000 - - mtm9672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
98.970

Return to query results.
Submit another query.