DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and Nsmce2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_017450247.1 Gene:Nsmce2 / 299957 RGDID:1305156 Length:273 Species:Rattus norvegicus


Alignment Length:162 Identity:41/162 - (25%)
Similarity:74/162 - (45%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLTKNSSNTIEKSE----------EVCKERPEAVEQMR---IDVNNSLEDT-NYMNAVESEAQKN 80
            |..|||....:::|          |:.|:..:..|..|   .|.|.....| |..:.:.::.:.:
  Rat   111 LQDKNSDADFKENEKFVQFKQQLRELKKQLVKPREDGRHNEFDPNKDSSRTGNERDGIHADREND 175

  Fly    81 -IAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMII----KDNIGILCP 140
             |.|:|||:|:..   ....|..|.::|.:|.||:||.|||.|:.|.::.:|    |......||
  Rat   176 GIEGMDEDMIVTQ---SQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCP 237

  Fly   141 VRDCPNLSDIKLEHLVKDPDVEQELQKRKSDK 172
            ...|.: :|:::..|:.|..:.:.::.....|
  Rat   238 KIGCSH-TDMRMSDLIPDEALRRAIESHNKKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 20/61 (33%)
Nsmce2XP_017450247.1 zf-Nse 182..242 CDD:288622 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12168
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.