DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and NSMCE2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_016868819.1 Gene:NSMCE2 / 286053 HGNCID:26513 Length:249 Species:Homo sapiens


Alignment Length:198 Identity:45/198 - (22%)
Similarity:76/198 - (38%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AEVVSNSSDDGEKL-----------LTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSL------ 64
            |||.|..|.|...:           ..|...:||...:|   ||||.:..:::.|....      
Human    55 AEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKE---ERPEKIPDLKLLVEKKFLALQSK 116

  Fly    65 -EDTNYMN--------------------AVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLL 108
             .|.::.|                    ..:.||. ...|:|||:|:..   ....|..|.:|..
Human   117 NSDADFQNNEKFVQFKQQLKELKKQCGLQADREAD-GTEGVDEDIIVTQ---SQTNFTCPITKEE 177

  Fly   109 IKHPVRNKRCGHIYDRETVLMII----KDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            :|.||:||.|||.|:.:.::.:|    |......||...|.: :||:...|::|..:.:.::...
Human   178 MKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSH-TDIRKSDLIQDEALRRAIENHN 241

  Fly   170 SDK 172
            ..:
Human   242 KKR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 19/61 (31%)
NSMCE2XP_016868819.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12292
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5364
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.