DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and nse2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001343015.1 Gene:nse2 / 2542312 PomBaseID:SPAC16A10.06c Length:250 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:38/176 - (21%)
Similarity:69/176 - (39%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLED------- 66
            :.::|:|:.:.....||.|:   .......||..:.:..|:           |....|       
pombe   104 YTQIFKELIQEYEEKSDYGK---YGTQGEYIEFKKTIWHEQ-----------NTDGSDFPSMKTF 154

  Fly    67 TNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHD--PWSKLLIKHPVRNKRCGHIYDRETVLM 129
            .|.||..|.||       ||.::..      ..|.:  |.:...|.||:.:..|.|.|:::.:|.
pombe   155 FNVMNTEEQEA-------DEVMVYS------ATFDNRCPLTLQPIVHPILSTACNHFYEKDAILS 206

  Fly   130 IIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIKN 175
            ::  |...:|||..|    :.:|:..:...|...|.:.|::.:|.|
pombe   207 LL--NPTCVCPVVGC----EARLQRSLLKEDEILERRLRRAQEISN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 14/59 (24%)
nse2NP_001343015.1 RING_Ubox 4..250 CDD:327409 38/176 (22%)
SPL-RING finger 179..219 CDD:319565 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.