DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and ZK1248.11

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001380006.1 Gene:ZK1248.11 / 173987 WormBaseID:WBGene00022881 Length:201 Species:Caenorhabditis elegans


Alignment Length:192 Identity:44/192 - (22%)
Similarity:80/192 - (41%) Gaps:35/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKLFREMAE---------VVSNSSDDGE--KLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNS 63
            :|..|:.||         .:||..|..|  :.|.|::...:|...|.. :.....|.:..|:.:.
 Worm    13 RKSLRKAAEDVLHINSKNAISNEVDSEEFKETLMKDAMKLMELETEGA-QMQHIFEALHNDLKDG 76

  Fly    64 LEDTNYMNAVE------SEAQKNIAG---LDEDLIM--------EDFGVEVVPFH----DPWSKL 107
            .::.....|:|      .:..||:.|   ..:|:|.        ::..:||:...    ||.||.
 Worm    77 SDEVPNEKALEELYEKAKKTHKNVKGERQYFKDIIKSIRDESKNDENEMEVMQVQHSRKDPISKK 141

  Fly   108 LIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            .|.:||.:|.|||:|||:::.........|.|.::.|.  ..|.:..|...||....:::::
 Worm   142 DIVNPVISKNCGHVYDRDSIHEFAGKKRVIKCAMQGCS--ETINIGQLADYPDYWTNIKQQQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 20/69 (29%)
ZK1248.11NP_001380006.1 SPL-RING_NSE2 134..199 CDD:319565 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167564
Domainoid 1 1.000 45 1.000 Domainoid score I8246
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006721
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.