DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42299 and nsmce2

DIOPT Version :9

Sequence 1:NP_727866.2 Gene:CG42299 / 32487 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031759369.1 Gene:nsmce2 / 100497178 XenbaseID:XB-GENE-13579717 Length:238 Species:Xenopus tropicalis


Alignment Length:176 Identity:51/176 - (28%)
Similarity:79/176 - (44%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKLFREMAEVVSN-SSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLEDTNYMNAV 73
            |||.||..|.|.: .|...||..|....||    :|..|:....|:     ..:.|.:.......
 Frog    81 QKLRREQIEQVPDLLSQVQEKYATIQGKNT----DEDLKKNGRFVQ-----FKDQLREMRKQMGE 136

  Fly    74 ESEAQKNIAGLDEDLIMEDFGVEVVP----FHDPWSKLLIKHPVRNKRCGHIYDRETVLMIIKD- 133
            :.|.:.....:|||       :.|:|    |..|.:::.:.:||:||.|||.|::|.:..||:| 
 Frog   137 KEEGEGAFENVDED-------IAVMPSQQNFTCPITQMKMTNPVKNKVCGHTYEKEAIERIIQDK 194

  Fly   134 ---NIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIKNE 176
               .....||:..|.: ||::|..|  .||.   |.||..| ::|:
 Frog   195 HQRKKRATCPIIGCDH-SDMQLSDL--GPDT---LLKRAID-VQNK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 20/65 (31%)
nsmce2XP_031759369.1 SPL-RING_NSE2 160..229 CDD:319565 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12191
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.