DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gucy2g

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:253 Identity:77/253 - (30%)
Similarity:128/253 - (50%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 RQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMH 362
            |:|..||:..||::.:::|..|.:.|:         ||                 ||: .|.|  
Mouse   861 RELVAEKRKVEKLLSTMLPSFVGEQLI---------AG-----------------KSV-EPEH-- 896

  Fly   363 SMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCP- 426
             .|:|:|.|:||||||::.|..:..|:|::||||:..||.........|:.|:||.|...||.| 
Mouse   897 -FESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPI 960

  Fly   427 EPRADHAICCVEMGLGMIDAMRCFDA--QRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVS 489
            ...|.||.....|.|.::.....|..  ...|.:|:|:|:|||.|:.|:||....::.::.:.|:
Mouse   961 RNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVN 1025

  Fly   490 LANKMESSGKPEQVHISQETSSFL--GDAYYLE---------EGEEVFGHRTYFVVGR 536
            :|::||||..|.::|:||.|:..|  ...|:|:         :||:.    |:::.|:
Mouse  1026 MASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQT----TFWLKGK 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 69/220 (31%)
Guanylate_cyc 361..535 CDD:278633 61/187 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 69/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.