DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gucy1a2

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:372 Identity:97/372 - (26%)
Similarity:152/372 - (40%) Gaps:88/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 MEANGD-----PSNRILILRIMA------------HLS---VH-------LVGVHV-----LIMN 279
            ||..|.     .||.||.|....            |||   :|       |||...     |...
  Rat   402 MEIKGQMIHVPESNAILFLGSPCVDKLDELIGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKR 466

  Fly   280 LVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYM 344
            :.:::.|..|..|      .||.||:....:::|:.|..||..|                   :.
  Rat   467 MDKLKATLEKTHQ------ALEEEKKKTVDLLYSIFPGDVAQQL-------------------WQ 506

  Fly   345 RPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGC 409
            |.:.           .....::|::||:||||||.:.:..|..|::.:||:|:.|||..|.....
  Rat   507 RQQV-----------QARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDI 560

  Fly   410 EKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIV 474
            .|:.|:||.|...||.......||.....|.|.|::............::||:|:|:|:||.|:|
  Rat   561 YKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVV 625

  Fly   475 GTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGEEVFGHRTYFVVGRRRD 539
            |.|..::.::.|:|:||:|.||...|.:::||..|       |.|.:.|:.|   |:  :.|.|:
  Rat   626 GVRMPRYCLFGNNVTLASKFESGSHPRRINISPTT-------YQLLKREDSF---TF--IPRSRE 678

  Fly   540 FTRTNSLSPSMPANATGSSLLL---PGAHGASLSQSATNVSAVQPNV 583
                 .|..:.|....|....|   .|......|.|::.:..|..|:
  Rat   679 -----ELPDNFPKEIPGVCYFLELRTGPKPPKPSLSSSRIKKVSYNI 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 60/215 (28%)
Guanylate_cyc 361..535 CDD:278633 57/173 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 25/104 (24%)
CYCc 483..672 CDD:214485 64/228 (28%)
Guanylate_cyc 512..696 CDD:278633 62/200 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.