DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gucy2ca

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_009297342.1 Gene:gucy2ca / 572052 ZFINID:ZDB-GENE-091118-67 Length:1025 Species:Danio rerio


Alignment Length:394 Identity:103/394 - (26%)
Similarity:173/394 - (43%) Gaps:49/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1273 FLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEI-----KWFQDYHVEI---YLDLLLILV 1329
            |...|.|.|:..::..::...:|..::|.|.....:.|     |.|.:.|.:.   |:|.|:..:
Zfish   652 FRPDLSFEGVGETEAELFVLIKSCWEEDPEKRPDFKRIEGALGKIFSNLHNQANASYMDNLIRRL 716

  Fly  1330 LVWFLNREFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAKYS-ENHH 1393
            .::..|.|..:..|...|   .|.:|:         ||.|...::|..|...||.|.:.. |.:.
Zfish   717 QMYSRNLEHLVEERTALY---KAERDR---------ADQLNFMLLPGPVVRSLKETGRVEPELYD 769

  Fly  1394 NIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGL 1458
            .:.|.|:.||.|..:...|  ...|.:.:||::..:||.:|...:   |.|::|||..:|.||||
Zfish   770 EVTIYFSDIVGFTTICHHS--TPMEVVDMLNDIYKNFDSILDHHD---VYKVETIGDAYMVASGL 829

  Fly  1459 DPSHRGTGDEHIHTLMEFSIAMQEVVDAFN-KDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIW 1522
            .   |..|:.|...:...::.:.|.:..|. :.|....|.:|||::.|...|||:|.....|.::
Zfish   830 P---RCNGNRHAVDICLMALDILEFMGTFQLRHLPGIPLWIRIGIHSGPCAAGVVGNKMPRYCLF 891

  Fly  1523 GDAVNVASRMDSTGLPNRIQVGKDCLPFLTN---RYEFEPRGSVYVKGK-DHMEVFLY------- 1576
            ||.||.||||:|||||.||.|.:..:..|..   .:|.|.||..::||| ..|..:|.       
Zfish   892 GDTVNTASRMESTGLPLRIHVSESTIKILQRTDCEFECERRGETFLKGKGKEMTYWLTGVTGQKY 956

  Fly  1577 ------TTRRDNPLDDDEADKVEQLGTKKMEHEGRDEDVVQGEQQAEDKDEEEEEEEEDDDLHSS 1635
                  |......|..|.|:::  :.|.......|.:.:...:::..........:.:.:.||.:
Zfish   957 SLPTPPTVENFQRLQQDLAERI--VSTLNKRGNERRKTLSTRQRRTHTHIHTHSGDGQPEYLHLT 1019

  Fly  1636 ETTT 1639
            :.||
Zfish  1020 DPTT 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 64/198 (32%)
Guanylate_cyc 1388..1575 CDD:278633 64/192 (33%)
gucy2caXP_009297342.1 Periplasmic_Binding_Protein_Type_1 31..365 CDD:299141
PKc_like 428..698 CDD:304357 9/45 (20%)
Pkinase_Tyr 451..689 CDD:285015 7/36 (19%)
CYCc 736..929 CDD:214485 66/209 (32%)
Guanylate_cyc 763..950 CDD:278633 65/194 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.