DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and npr1a

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:280 Identity:79/280 - (28%)
Similarity:142/280 - (50%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GVHVLIMNLVRMRGTFMKVGQNL--LVRRQLEM---EKQLKEKMIHSVMPPKVADMLLNEGGPSG 331
            |.::|...|.||.    :...||  ||..:.:.   ||:..|.:::.::|..||:.|        
Zfish   816 GSNILDNLLSRME----QYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQL-------- 868

  Fly   332 LDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDL 396
                           :....|::       .:.::|:|.|:||||||.:|:..|..::|.:||||
Zfish   869 ---------------KRGEMVQA-------EAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDL 911

  Fly   397 FERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRHE---G 457
            :..||.:.......|:.|:||.|..|||.|..... ||.....|.|.:::|:..|.. ||.   .
Zfish   912 YTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRI-RHRPNLQ 975

  Fly   458 VKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGD--AYYLE 520
            :::|:|:|:|.|..|:||.:..::.::.:.|:.|::|||:|:..::|:|:.|.:.|.:  .:.||
Zfish   976 LRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLE 1040

  Fly   521 -EGE-EVFGH---RTYFVVG 535
             .|: |:.|.   |||:::|
Zfish  1041 LRGDVEMKGKGRMRTYWLLG 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 61/224 (27%)
Guanylate_cyc 361..535 CDD:278633 61/184 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944
TyrKc 554..808 CDD:197581
HNOBA <823..868 CDD:285003 13/48 (27%)
CYCc 847..1032 CDD:214485 60/215 (28%)
Guanylate_cyc 874..1060 CDD:278633 62/193 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.