DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gucy1b2

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:286 Identity:85/286 - (29%)
Similarity:142/286 - (49%) Gaps:44/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 MAHLSVHLVGVHVLIMNLVRMRGTFM------KVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVAD 321
            :|.::.|.....::::|..|:....:      |..:..::.|.||:|||..||::::::|..||:
Zfish   387 LADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEIEKQKSEKLLYAMLPTHVAN 451

  Fly   322 MLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTA 386
            . |.||  ..::||                           ..:..:|||:|:|.||.:.:....
Zfish   452 Q-LKEG--KRVEAG---------------------------EFKVCTILFSDVVTFTNICAACEP 486

  Fly   387 EQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGM-IDAMRCF 450
            .|:|.:||.::.|||.|.|:....|:.|:||.|..|.|.|.|...||.......||| |.|....
Zfish   487 IQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGMRIAAREVT 551

  Fly   451 DAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGD 515
            :....:.:::|||:|||.||.|:||.:..::.::.:.|:.|::|||.|.|:.:|:|..|.|.:.|
Zfish   552 NPITGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFSVIKD 616

  Fly   516 AYYLEEGE----EVFGH---RTYFVV 534
            ....|..|    ||.|.   ||||::
Zfish   617 KGIFEMAERGEIEVKGKGLMRTYFLL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 68/216 (31%)
Guanylate_cyc 361..535 CDD:278633 64/182 (35%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454
HNOBA 269..453 CDD:285003 16/66 (24%)
CYCc 432..618 CDD:214485 68/215 (32%)
Guanylate_cyc 459..642 CDD:278633 66/209 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.