DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and npr1b

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:290 Identity:80/290 - (27%)
Similarity:143/290 - (49%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 HVLIMNLVRMRGTFMKVGQNLLVRRQ-----------------LEMEKQLKEKMIHSVMPPKVAD 321
            |:.::...:.|.....:..|||.|.:                 || ||:..|.:::.::|..||:
Zfish   807 HISVLLRKQNREHRSNILDNLLSRMEQYANNLEELVEERTQAYLE-EKRKAEALLYQILPHSVAE 870

  Fly   322 MLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTA 386
            .|                       :....|::       .:.::|:|.|:||||||.:|:..|.
Zfish   871 QL-----------------------KRGETVQA-------EAFDSVTIYFSDIVGFTSLSAESTP 905

  Fly   387 EQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCF 450
            .|:|.:||||:..||.:.......|:.|:||.|..|||.|..... |......|.|.:::|::.|
Zfish   906 LQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTF 970

  Fly   451 DAQRH---EGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSF 512
            .. ||   |.:|:|:|:|:|.|..|:||.:..::.::.:.|:.:::|||:|:|.::|:|..|.:.
Zfish   971 KI-RHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAV 1034

  Fly   513 LGD--AYYLE-EGE-EVFGH---RTYFVVG 535
            |.:  .:.|| .|: |:.|.   |||:::|
Zfish  1035 LQEFNCFQLELRGDVEMKGKGKMRTYWLLG 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 63/221 (29%)
Guanylate_cyc 361..535 CDD:278633 63/184 (34%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
npr1bXP_009290669.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.