DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Phlpp2

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001102601.2 Gene:Phlpp2 / 498949 RGDID:1562857 Length:1359 Species:Rattus norvegicus


Alignment Length:504 Identity:100/504 - (19%)
Similarity:162/504 - (32%) Gaps:149/504 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 SPPLLPPANPPAAETRSKIKLKVWKIPRFLKRFEDLTNRSSC------GGSS-------SAGHLD 721
            |..||....|..|:..|...|.|             .|..:|      ||..       |..|..
  Rat   909 SSALLCYIRPDTADPTSSFSLTV-------------ANVGTCQAVLCRGGKPVPLSKVFSLEHDP 960

  Fly   722 KEREREREKEKEELHQHNQLNPEETLAFMDNQMQNGNGCGYQQLPVLVESNHRTQT-LDIPAARP 785
            :|.:|.:: :|..:.:.|::|.......|       .||.| ..|.::...|.:.| |.|.....
  Rat   961 EEAQRVKD-QKAIITEDNKVNGVTCCTRM-------LGCTY-LYPWILPKPHISSTPLTIQDELL 1016

  Fly   786 VLHHAA----TSTALASSVLRSPEAGVSGGGGCCSPGQ-YSMYDDIIDVRSYISQSRSDISPFGR 845
            :|.:.|    .|...|.|.:|..:..::.....|:..| |...|::..:..|::        .|.
  Rat  1017 ILGNKALWEHLSYLEAVSAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLN--------IGE 1073

  Fly   846 SGSYRSQCGRQSTGGVNGAGPA---------------GVGAE--GRAGTSQTAPPV--------- 884
            .|......|....|.|..|..|               |:.:|  ....||:.:..|         
  Rat  1074 EGCTCEMHGLALPGPVGFASTATIKDAPKPTTPSSSSGIASELSSEVSTSEVSSEVGSTASDEHN 1138

  Fly   885 ----EQSPLPRPRASTLATGRPTPNSLEPGPSSTSPCCLPAPGNSVGGGGIFPPTHSRQSSICPS 945
                |.|.||||....         ||.|.||:                    .|..||.|....
  Rat  1139 TVGLETSLLPRPERRC---------SLHPVPSA--------------------GTFQRQPSCATF 1174

  Fly   946 ATSRKDSGIKS-----------NSRRSSIQQQIYAL----NQTAISQHRVSGYFTSSTSSISNLG 995
            ::::.|:|:.|           |..|..::..|:..    ::.:.:..:.|.|..|..       
  Rat  1175 SSNQSDNGLDSDDDQPVEGVITNGSRVEVEVDIHCCRGRESENSPTLPKNSSYPCSEE------- 1232

  Fly   996 EVQGLGLPLAVQPP--PPLLMPACSSQM---ADPLAACL--QQLRK------QSDLQLIRCVRDN 1047
            ..:|||..:..|..  ..:|:|....:|   ..|..:||  ::|..      :..|.||....:.
  Rat  1233 HARGLGFGIRRQNSVNSGILLPVNKDKMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEA 1297

  Fly  1048 ARSQRSYLVKP-PLRKFSLYFKSRQLERDFRS--KAHRFGAENETEGPP 1093
            .:.:..|...| .|.....:...|.||.:.:.  |.|:   |:..|..|
  Rat  1298 PKRKTGYFAAPTQLEPEDQFVVPRDLEDEVKEQMKQHQ---ESRPEPEP 1343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Phlpp2NP_001102601.2 RA_PHLPP2 66..178 CDD:340761
PH_PHLPP-like 185..279 CDD:270131
PLN00113 284..>762 CDD:215061
leucine-rich repeat 289..309 CDD:275380
leucine-rich repeat 310..336 CDD:275380
leucine-rich repeat 337..359 CDD:275380
leucine-rich repeat 360..382 CDD:275380
leucine-rich repeat 383..405 CDD:275380
leucine-rich repeat 406..428 CDD:275380
leucine-rich repeat 429..452 CDD:275380
leucine-rich repeat 453..476 CDD:275380
leucine-rich repeat 477..497 CDD:275380
leucine-rich repeat 498..517 CDD:275380
leucine-rich repeat 518..539 CDD:275380
leucine-rich repeat 540..562 CDD:275380
leucine-rich repeat 563..584 CDD:275380
leucine-rich repeat 586..607 CDD:275380
leucine-rich repeat 608..631 CDD:275380
leucine-rich repeat 632..681 CDD:275380
leucine-rich repeat 682..705 CDD:275380
leucine-rich repeat 706..728 CDD:275380
leucine-rich repeat 751..772 CDD:275380
PP2Cc 820..1069 CDD:238083 38/181 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.