DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and NPR2

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:282 Identity:83/282 - (29%)
Similarity:143/282 - (50%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GVHVLIMNLVRMRGTFMKVGQNL--LVRRQLEM---EKQLKEKMIHSVMPPKVADMLLNEGGPSG 331
            |..:|...|:||.    :...||  ||..:.:.   ||:..|.:::.::|..||:.|        
Human   850 GTSILDNLLLRME----QYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQL-------- 902

  Fly   332 LDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDL 396
                           :....|::       .:.::|:|.|:||||||.:|:..|..|:|.:||||
Human   903 ---------------KRGETVQA-------EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDL 945

  Fly   397 FERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQR--HEGV 458
            :..||.:.......|:.|:||.|..|||.|..... ||.....|.|.::||:..|..:.  |:.:
Human   946 YTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQL 1010

  Fly   459 KMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGD--AYYLE- 520
            ::|:|||||.|..|:||.:..::.::.:.|:.|::|||:|:..::|:|..|...|.:  .:.|| 
Human  1011 RLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLEL 1075

  Fly   521 EGE-EVFGH---RTYFVVGRRR 538
            .|: |:.|.   |||:::|.|:
Human  1076 RGDVEMKGKGKMRTYWLLGERK 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 64/223 (29%)
Guanylate_cyc 361..535 CDD:278633 64/183 (35%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573 13/48 (27%)
CYCc 881..1065 CDD:214485 63/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.