DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:428 Identity:112/428 - (26%)
Similarity:174/428 - (40%) Gaps:99/428 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LTYTGRAFS----------------------PLGHFAICLEIVLLIYTALPMPLWLGAST---AI 211
            |...||.||                      |.|......:||...||    |..:|.:.   |:
  Fly   282 LVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTYT----PFLIGLNNPPGAV 342

  Fly   212 SY-SIAFEMVSHMVIGCSAIHGGPMHGGGGAAGGSGMEANGDPSNRILILRIMAH---LSVHLVG 272
            .: :|..|:...|| .|...:.....|.....|..|:..||     :.|..|..|   ..|.|||
  Fly   343 DFPAIGLEIKGQMV-HCPESNSLLFIGSPFLDGLDGLTCNG-----LFISDIPLHDATREVILVG 401

  Fly   273 VHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKE--KMIHSVMPPKVADML-LNEGGPSGLDA 334
            ......:.:|.|   |...:|.:......:.|:.|:  .::|.:.|.::|:.| |.    |.:||
  Fly   402 EQARAQDGLRRR---MDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLG----SSIDA 459

  Fly   335 GGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFER 399
            ...|                           :|:|||:||||||.:.|..|...::.:|..|::.
  Fly   460 KTYP---------------------------DVTILFSDIVGFTSICSRATPFMVISMLEGLYKD 497

  Fly   400 FDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEG--VKMRV 462
            ||:.|......|:.|:||.|...||........|.....|.|.||||  |.....|:|  :|||:
  Fly   498 FDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDA--CSKHITHDGEQIKMRI 560

  Fly   463 GVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFL----GDAYYLEEGE 523
            |:||||||.|:||.:..::.::.:.|::|||.||..:..::::|..|..:|    |..:.|:..:
  Fly   561 GLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRD 625

  Fly   524 EVF---------GHRT-YFVVGRRRDFTRTNSLSPSMP 551
            ..|         |..| ||:     :..|..:|...:|
  Fly   626 PSFLPKEFPNPGGTETCYFL-----ESFRNPALDSELP 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 68/224 (30%)
Guanylate_cyc 361..535 CDD:278633 63/189 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 40/181 (22%)
CYCc 430..619 CDD:214485 68/221 (31%)
Guanylate_cyc 457..647 CDD:278633 66/223 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.