DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and CG10738

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:604 Identity:156/604 - (25%)
Similarity:231/604 - (38%) Gaps:163/604 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RRQSVS-SRAMPPGV-LVNDSRANS--------TDDIQIALAPHIQTYLSQTGRRHSCCSVMLPV 59
            |::||. :|.|...: |:.|:|.::        ||...|.:   |..|         |....|..
  Fly   608 RKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICI---ISEY---------CTRGSLKD 660

  Fly    60 AFERAAAKSWLDPKFDSPVLEEQYQASVFPH---VRMRYRFTLSYILLCSLMWCL------YFVV 115
            ..|....|  ||..|.:.::.:..:..::.|   :|.......|..|:.| .|.:      .|..
  Fly   661 ILENEDVK--LDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDS-RWVVKLTDFGLFAF 722

  Fly   116 DGGSEDFWRPISSSFSMLSLVTIMALCFTHWDLYREHRTVTSAVTALLLCG-ASLAFLTYTGRAF 179
            ..|.||         |...:..:.|.|...  |||        ...||..| :||...|..|.|:
  Fly   723 KQGIED---------SSTDMQHMSAKCLKL--LYR--------APELLRQGPSSLVMGTQRGDAY 768

  Fly   180 S-------------PLGHFAI----CLEIVLL------IYTALPMPLWLGASTAISYSIAFEMVS 221
            |             |.|...:    ||:.||.      .|.....||          ..||:.||
  Fly   769 SFGILLYEMHVRRGPFGETGLTPMQCLQKVLQPQDYLNPYRPSLQPL----------ETAFDCVS 823

  Fly   222 HMVIGCSAIHGGPMHGGGGAAGGSGMEANGDPSNRILILRIMAHLSVHLVGVHVLIMNLVRMRGT 286
            ..:..|.|..                     |.:|.....|...|.....|:...|.:  .|...
  Fly   824 ECLRECWAER---------------------PEDRPDFKTIRTKLRPLRKGMRPNIFD--NMMAM 865

  Fly   287 FMKVGQNL--LV---RRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRP 346
            ..|...||  ||   ..||:.||:..:.::|.::|..|||. |.:|..       :.|| ||   
  Fly   866 MEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQ-LKKGHK-------VDPE-HY--- 918

  Fly   347 RASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEK 411
                              |.|||.|:||||||.||:..|..|:|:.||||:..||.:.......|
  Fly   919 ------------------EQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYK 965

  Fly   412 ISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEGVK---MRVGVHTGTVLCG 472
            :.|:||.|..|||.|....| ||.....|.|.::.|:..|.. ||....   :|:|:|:|.|..|
  Fly   966 VETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKI-RHRPTNRLLLRIGIHSGPVCAG 1029

  Fly   473 IVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSF---LGDAYYLEEG----EEVFGHRT 530
            :||.:..::.::.:.|:.|::|||||.|.::|.|.:....   ||..::.|.|    :.....||
  Fly  1030 VVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRT 1094

  Fly   531 YFVVGR------RRDFTRT 543
            |:::|.      ||.:.|:
  Fly  1095 YWLLGEDEEARTRRTYERS 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 73/222 (33%)
Guanylate_cyc 361..535 CDD:278633 65/184 (35%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 64/309 (21%)
TyrKc 597..847 CDD:197581 63/303 (21%)
HNOBA <862..907 CDD:285003 15/45 (33%)
CYCc 886..1078 CDD:214485 73/222 (33%)
Guanylate_cyc 913..1099 CDD:278633 69/208 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.