DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and CG3216

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster


Alignment Length:235 Identity:73/235 - (31%)
Similarity:123/235 - (52%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 RQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGL-PPESHYMRPRASNDVKSLFRPFHM 361
            |||.:|||..|::::.::|..||..|:         ||.| .||                     
  Fly   914 RQLSLEKQRTEELLYQILPRPVAQQLM---------AGDLVEPE--------------------- 948

  Fly   362 HSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCP 426
             ...:|:|.|:||||||.:.:..:...:|..||||:..||.:.......|:.|:||.|..|||.|
  Fly   949 -EFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLP 1012

  Fly   427 EPRAD-HAICCVEMGLGMIDAMRCFDAQRHE---GVKMRVGVHTGTVLCGIVGTRRVKFDVWSND 487
            ||..| ||.....|.|.::.|:..|:. ||:   .:::|:|:|:|:|..|:||.:...:.::.:.
  Fly  1013 EPNGDKHAREIALMALDILRAVSSFNL-RHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDT 1076

  Fly   488 VSLANKMESSGKPEQVHISQETSSFLG--DAYYLEEGEEV 525
            |:.|::|||:|:|.::|:|..|.:.|.  ..:.:|:..:|
  Fly  1077 VNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDV 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 68/222 (31%)
Guanylate_cyc 361..535 CDD:278633 57/171 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 10/24 (42%)
CYCc 918..1109 CDD:214485 68/222 (31%)
Guanylate_cyc 945..1131 CDD:278633 59/195 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.