DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Phlpp

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:488 Identity:95/488 - (19%)
Similarity:165/488 - (33%) Gaps:144/488 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LVRR--QLEMEKQ--LKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSL 355
            |:||  ||.:.|.  :::..|||:..|.|.:::|: .....|..|.....|.....||:.:::. 
  Fly   562 LIRRTSQLRLTKPDVIQKDQIHSMPDPHVLELILS-NDDEYLVVGNAQLWSVMDIDRAAREIRK- 624

  Fly   356 FRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYY 420
                     |..|:|.|     .|:.....:....|.|:.:..||..|    |.:....:.:...
  Fly   625 ---------EENSLLAA-----KRLVDIAQSFAAAESLSVIVVRFRHL----GTDVDHLIRELKQ 671

  Fly   421 CVSGCPEPRADHAICCVEMGLGMIDAMRCFD---AQRHEGVKMRVGVHTGTVLCGIVGTRRVKFD 482
            .|...|:|      ..:.:..|.:....|.|   |.||..::..                     
  Fly   672 SVRKKPQP------VSLPLSSGSVCKRTCCDRSNACRHRAIEQE--------------------- 709

  Fly   483 VWSNDVSLANKMESSGKPEQVHISQETSS--FLGDAYYLEEGEEVFGHRTYFVVGRRRDFTRTNS 545
                  .||.:...||:.::..::::...  .|..|..|:|.:::            .....|.|
  Fly   710 ------PLAGRSSPSGQSDRDLLAKDKDDEFVLAHARVLQEEQQL------------EMLDETES 756

  Fly   546 LSPSMPAN---------ATGSSLLLPGAHGASLSQSATNVSAVQPNVPPASPVGQLSSSLNPSPV 601
            :|.|:.:.         ...::.||......::|:|.|.    |..||         :::..:.|
  Fly   757 VSESVLSEEQFKCWEYMLEQNTQLLFDKELNTISKSFTK----QRTVP---------NAIMAATV 808

  Fly   602 LSMRPRLTSLSMKMRKKSQSRDRDVERGIIHPAAAGIPPVIVVRERPKIIITTKSLP-GSLDSDE 665
            |..|...||..|          |.|....|..:...:|..|           |.|:| ||....:
  Fly   809 LPERNDFTSNLM----------RTVTNKFISTSTPQLPQPI-----------TTSVPLGSYHQVK 852

  Fly   666 QPPVSPPLLPPANPPAAETRSKIKLKVWKI----PRFLKRFEDLTNRSSCGGSSS-AGHLDK--- 722
            |       .||.:..:|.:..:.....:.:    ||  .:|...|.:.|.|.:|: .|.|.:   
  Fly   853 Q-------APPGHFGSALSFQQAHSYGYNLFDAKPR--PKFHGGTVKRSAGPNSAYFGSLQRLMP 908

  Fly   723 ---------EREREREKEKEELHQHNQLNPEET 746
                     .:||||....||.|..:..|..|:
  Fly   909 YNFEYDFAVTQERERNILDEEEHDDDDFNEHES 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 38/222 (17%)
Guanylate_cyc 361..535 CDD:278633 28/178 (16%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.