DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and GUCY2D

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:344 Identity:96/344 - (27%)
Similarity:157/344 - (45%) Gaps:82/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LIMNLVRMRGTFMKVGQNLLVRR--QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLP 338
            :|.:::||...:....::|:..|  :||:|||..::::..::||.||:.|..          |.|
Human   816 IIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKT----------GTP 870

  Fly   339 PESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDL 403
            .|..|                    .|.|::.|:||||||.:|:.....::|::||||:..||.:
Human   871 VEPEY--------------------FEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAI 915

  Fly   404 CSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRH---EGVKMRVGV 464
            .......|:.|:||.|...||.|:.... ||.....|.|.::.|:..| ..||   ..|::|:|:
Human   916 IGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTF-RMRHMPEVPVRIRIGL 979

  Fly   465 HTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSF---LGDAYYLE------ 520
            |:|..:.|:||....::.::.:.|:.|::|||:|.|.::|::..|...   |...|.:|      
Human   980 HSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTE 1044

  Fly   521 ---EGEEVFGHRTYFVVGRRRDFTRTNSLSPSMPANATGSSLLLPGAHGASLSQSATNVSAVQPN 582
               :|.|    .|:::||||    ..|...|..|....|||     .||.||.:           
Human  1045 LKGKGAE----DTFWLVGRR----GFNKPIPKPPDLQPGSS-----NHGISLQE----------- 1085

  Fly   583 VPP--------ASPVGQLS 593
            :||        |.| ||.|
Human  1086 IPPERRRKLEKARP-GQFS 1103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 63/222 (28%)
Guanylate_cyc 361..535 CDD:278633 56/189 (30%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945
HNOBA <820..865 CDD:369471 13/44 (30%)
CYCc 846..1036 CDD:214485 62/220 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.