DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and GUCY2F

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001513.2 Gene:GUCY2F / 2986 HGNCID:4691 Length:1108 Species:Homo sapiens


Alignment Length:341 Identity:91/341 - (26%)
Similarity:153/341 - (44%) Gaps:72/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LIMNLVRMRGTFMKVGQNLLVRR--QLEMEKQLKEKMIHSVMPPKVADMLLNEG---GPSGLDAG 335
            :|.:::||...:....::|:..|  :||:|||..||::..::||.||:. |.:|   .|.|.|. 
Human   820 IIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAES-LKKGCTVEPEGFDL- 882

  Fly   336 GLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERF 400
                                           |::.|:||||||.:|:.....::|::||||:..|
Human   883 -------------------------------VTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLF 916

  Fly   401 DDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRH---EGVKMR 461
            |.:.......|:.|:||.|...||.|:.... ||.....|.|.::.::..| ..||   ..|::|
Human   917 DAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTF-KMRHMPEVPVRIR 980

  Fly   462 VGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGEEVF 526
            :|:|:|.|:.|:||....::.::.:.|:.|::|||:|.|.::|:|..|.:.|.:   |.||.|| 
Human   981 IGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQN---LSEGYEV- 1041

  Fly   527 GHRTYFVVGRRRDFTRTNSLSPSMPANATGSSLLLPGAHGASLSQSATNVSAVQPNVPPASPVGQ 591
                 .:.||           ..:....|..:..|.|..|         .....|..||....||
Human  1042 -----ELRGR-----------TELKGKGTEETFWLIGKKG---------FMKPLPVPPPVDKDGQ 1081

  Fly   592 LSSSLNPSPVLSMRPR 607
            :...|.|..:.:.:.|
Human  1082 VGHGLQPVEIAAFQRR 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 65/222 (29%)
Guanylate_cyc 361..535 CDD:278633 56/177 (32%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
GUCY2FNP_001513.2 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357
HNOBA <824..869 CDD:285003 15/45 (33%)
CYCc 848..1040 CDD:214485 68/228 (30%)
Guanylate_cyc 875..1062 CDD:278633 63/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.