DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and GUCY1A1

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens


Alignment Length:339 Identity:89/339 - (26%)
Similarity:143/339 - (42%) Gaps:75/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 GSGMEANGDPSNRILILRIMAHLSVHLVGVHV-----LIMNLVRMRGTFMKVGQNLLVRRQLEME 303
            |.|:..:..|.:..|       ..|.|:|...     |...|.:::.|..:..|      .||.|
Human   395 GRGLYLSDIPIHNAL-------RDVVLIGEQARAQDGLKKRLGKLKATLEQAHQ------ALEEE 446

  Fly   304 KQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVS 368
            |:....::.|:.|.:||..|. :|                             :........||:
Human   447 KKKTVDLLCSIFPCEVAQQLW-QG-----------------------------QVVQAKKFSNVT 481

  Fly   369 ILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-H 432
            :||:||||||.:.|..:..|::.:||.|:.|||..|......|:.|:||. |||:|.....:| |
Human   482 MLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDA-YCVAGGLHKESDTH 545

  Fly   433 AICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESS 497
            |:....|.|.|::......:...|.:|||:|:|:|:|..|:||.:..::.::.|:|:||||.||.
Human   546 AVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESC 610

  Fly   498 GKPEQVHISQETSSFLGDAYYLEEGEEVFGHRTYFVVGRRRDFTRTNSLSPSMPANATGSSLLLP 562
            ..|.::::|..|...|.|.            ..:....|.|:     .|.|:.|:.       :|
Human   611 SVPRKINVSPTTYRLLKDC------------PGFVFTPRSRE-----ELPPNFPSE-------IP 651

  Fly   563 G-AHGASLSQSATN 575
            | .|.....|..||
Human   652 GICHFLDAYQQGTN 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 65/216 (30%)
Guanylate_cyc 361..535 CDD:278633 57/174 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 19/83 (23%)
Guanylate_cyc 472..643 CDD:306677 59/188 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.