DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Npr3

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:46/106 - (43%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 RYNTYIDIFVGIAVYLCI-SVSLFLMTQNTVSPSFRLWVTLFSCFTGIQVFALFLF-TRQMCRRQ 1161
            |.|.||.|::.|.:|:.| .:||::..:.|...|...:  |||      .||.|.| .|.:....
  Rat     5 RENIYIYIYIYIYIYIYIFIISLYVYYRRTGLHSVNFF--LFS------FFAFFFFKPRDIAEES 61

  Fly  1162 S----GSNVSNRF------RSKSTTSEDLERDERGAAPGGR 1192
            |    |:.:...|      :......::..|:|||...||:
  Rat    62 SSLSFGALLKGVFCFLGAPKGAQGQRKEKSREERGRVGGGQ 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381
ANF_receptor 182..535 CDD:279440
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.