DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Npr1

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:133/251 - (52%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 EKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENV 367
            ||:..|.:::.::|..||:.|                       :....|::       .:.::|
  Rat   837 EKRKAEALLYQILPHSVAEQL-----------------------KRGETVQA-------EAFDSV 871

  Fly   368 SILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD- 431
            :|.|:||||||.:|:..|..|:|.:||||:..||.:.......|:.|:||.|..|||.|..... 
  Rat   872 TIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQL 936

  Fly   432 HAICCVEMGLGMIDAMRCFDAQRH---EGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANK 493
            ||.....|.|.::||:|.|.. ||   |.:::|:|:|||.|..|:||.:..::.::.:.|:.|::
  Rat   937 HAREVARMALALLDAVRSFRI-RHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASR 1000

  Fly   494 MESSGKPEQVHISQETSSFLG--DAYYLE-EGE-EVFGH---RTYFVVGRRRDFTR 542
            |||:|:..::|:|.||.:.|.  |.:.|| .|: |:.|.   |||:::|.|...||
  Rat  1001 MESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERGCSTR 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 68/220 (31%)
Guanylate_cyc 361..535 CDD:278633 68/184 (37%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003 6/19 (32%)
CYCc 836..1025 CDD:214485 67/218 (31%)
Guanylate_cyc 863..1049 CDD:278633 69/193 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.