DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gucy2g

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_620611.2 Gene:Gucy2g / 245708 RGDID:621853 Length:1103 Species:Rattus norvegicus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:133/272 - (48%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHS 363
            ||..||:..||::.:::|..|.:.|:         ||                 ||: .|.|   
  Rat   865 QLVAEKRKVEKLLSTMLPSFVGEQLI---------AG-----------------KSV-EPEH--- 899

  Fly   364 MENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCP-E 427
            .|:|:|.|:||||||::.|..:..|:|::||||:..||.........|:.|:||.|...||.| .
  Rat   900 FESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQTHDVYKVETIGDAYMVASGLPIR 964

  Fly   428 PRADHAICCVEMGLGMIDAMRCFDA--QRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSL 490
            ..|.||.....|.|.::.....|..  ...|.:|:|:|:|||.|:.|:||....::.::.:.|::
  Rat   965 NGAQHADEIATMSLHLLSVTTNFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNM 1029

  Fly   491 ANKMESSGKPEQVHISQETSSFL--GDAYYLE---------EGEEVFGHRTYFVVGR------RR 538
            |::||||..|.::|:||.|:..|  ...|:|:         :||:.    |:::.|:      ..
  Rat  1030 ASRMESSSLPLRIHVSQSTARALLVAGGYHLQKRGTISVKGKGEQT----TFWLTGKDGFAVPLP 1090

  Fly   539 DFTRTNSLSPSM 550
            :||...:..|.:
  Rat  1091 EFTEEEAKVPEI 1102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 69/220 (31%)
Guanylate_cyc 361..535 CDD:278633 61/187 (33%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gucy2gNP_620611.2 PBP1_GC_G_like 50..439 CDD:107367
ANF_receptor 66..417 CDD:279440
PK_GC 558..832 CDD:270894
CYCc 868..1058 CDD:214485 69/219 (32%)
Guanylate_cyc 895..1081 CDD:278633 63/193 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.