DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-37

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:347 Identity:72/347 - (20%)
Similarity:132/347 - (38%) Gaps:110/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHS 363
            :||::|...::::...:||.:|:.|                       ||:..|.:       ..
 Worm   395 ELEVKKSQTDRLLFEFVPPVIAEAL-----------------------RAAKTVPA-------QE 429

  Fly   364 MENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEP 428
            ..:.|::|.||..|..:|...:..:::.::.|||.|||.:.......|:.:|.|.|..|.|.|..
 Worm   430 FSDCSVIFTDIPDFFTISVNCSPTEIITVVTDLFHRFDRIIEKHKGYKVLSLMDSYLIVGGVPNA 494

  Fly   429 RADHAICCVEMGLGMIDAMRCFDAQR------HEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSND 487
            ...|....:.:.||::     |:|::      ...|::|:|||.|.|:.|||..::.:|.|..|.
 Worm   495 NQYHCEDSLNLALGLL-----FEAKQVVVPKLERSVRLRIGVHCGPVVAGIVSQQKPRFCVLGNT 554

  Fly   488 VSLANKMESSGKPEQVHISQET---------SSFLGDA-------------YYLEEGEE------ 524
            |::...:.|...|.:|.:|...         |.|:.:|             ::||:.|:      
 Worm   555 VNVTKSICSHSSPGKVLVSNAVRTMVTKHLKSIFVFNANGYLELQSGKVLTHFLEKNEKCSVWDI 619

  Fly   525 ----------VFGHR-----------------TYFVVG-----------RRRDFTRTNSLS---P 548
                      :.|:|                 .|.|:.           .|:..||..|:.   .
 Worm   620 VDRDKATNDSIDGYRELHSDNGTEEWQEATVAAYRVISVVDALENKQSRTRKALTRLRSVKRKFR 684

  Fly   549 SMPANATGSSLLLPGAHGASLS 570
            ::.:|.:|.|:..|....|..|
 Worm   685 TIQSNDSGVSVSEPNVESAVCS 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 53/243 (22%)
Guanylate_cyc 361..535 CDD:278633 52/234 (22%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003 6/23 (26%)
CYCc 400..577 CDD:214485 50/211 (24%)
Nucleotidyl_cyc_III 425..609 CDD:299850 46/195 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.