DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-36

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:287 Identity:79/287 - (27%)
Similarity:128/287 - (44%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1352 ANQDKVRVQNM-------KNQADMLLHNIIPKHVAEHLK-NTAKYSENHHNIAIIFASIVNFNEM 1408
            ||.:  :::||       |.:.|.||..::|..||:.|| ..:..:..:....::|..:..|.::
 Worm   400 ANNE--QLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDVPTFQQI 462

  Fly  1409 YDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTL 1473
            .  .....|:.:.:||||...||.|:.   .:...|::|:|.::|:..|:.    ...|:|...:
 Worm   463 V--PLCTPKDIVHLLNELFTKFDRLIG---IQKAYKVETVGDSYMSVGGIP----DLVDDHCEVI 518

  Fly  1474 MEFSIAM----QEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDS 1534
            ...::.|    :.|.|......|.    :|.|::.|.|.|||:|.....|.::||.||.:|||:|
 Worm   519 CHLALGMVMEARTVCDPITNTPLH----IRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMES 579

  Fly  1535 TGLPNRI---QVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVF------------LYTTRRD--- 1581
            .....||   :..|.|.. .|.|:||||||.|.:|||..|..:            :...|||   
 Worm   580 HSPIGRIHCSENAKKCAE-STGRFEFEPRGRVQIKGKGEMNTYFLLRSFKRSIWEIIDRRRDENC 643

  Fly  1582 NPLD----------DDEADKVEQLGTK 1598
            |.:|          ||..:||.|..:|
 Worm   644 NSIDGYNELREGYVDDVLNKVTQKNSK 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 54/208 (26%)
Guanylate_cyc 1388..1575 CDD:278633 55/205 (27%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 11/36 (31%)
CYCc 415..604 CDD:214485 53/202 (26%)
Guanylate_cyc 441..624 CDD:278633 55/196 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.