DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-27

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001255957.2 Gene:gcy-27 / 191654 WormBaseID:WBGene00001550 Length:616 Species:Caenorhabditis elegans


Alignment Length:514 Identity:115/514 - (22%)
Similarity:192/514 - (37%) Gaps:147/514 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1184 ERGAAPGGRPHFESCADRIF---EAISSWYPWHIC--LAVLMAMPVLL---IIANFLLLDLEQLE 1240
            |||...      |.|.||.|   |...|.:...|.  |..|...||..   :.|...|:|:..:.
 Worm   143 ERGTLE------EFCLDRDFGMDETFKSAFMRDILKGLQYLHLSPVAYHGHLHAATCLIDINWVL 201

  Fly  1241 AFEYHYGFLIFVCIVHFCNFTQLNCWVRN----VLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQ 1301
            .... ||...|||    .||...|..:.:    .:::...:||         ...|.|......:
 Worm   202 KIAL-YGVTNFVC----DNFDAENITMPDRSDYTISYAQYVCF---------PPEHIREYDATGK 252

  Fly  1302 EASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRL---------------------T 1345
            ..:.|::..|....|.|.          :::::..|.|..|||                     .
 Worm   253 LPTRFVRGSKQGDIYCVG----------MIFYMMIEREDPYRLIHSVERPGSGLMMEILDHNLMP 307

  Fly  1346 FYGNAVANQD----------------KVRVQNMKN------------------------------ 1364
            |..|....:|                :..::|::|                              
 Worm   308 FISNNETQEDTLLDKCKECWNRDPEKRPTIENLRNAIAICYADSKGNLIDQMIRMNEKYADELET 372

  Fly  1365 -----QADM---------LLHNIIPKHVAEHLKN-TAKYSENHHNIAIIFASIVNFNEMYDESYL 1414
                 .||:         ||:.::|..:|:.||| ....:.::.:..::|..|.:|..:....  
 Worm   373 LVAARSADLALAQMQTMRLLNEMLPASIAKDLKNGVIAPARSYASATVMFVQICDFIVILKRR-- 435

  Fly  1415 GGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIA 1479
            ..||.:..||::...||.::.|.:   ..|::|.|.|:|.|||:...:.|   .|:..:.|.|:.
 Worm   436 PPKEVIGFLNDIFDQFDTVIKRHD---AYKVETTGETYMVASGVPNENEG---RHVFEVAEMSLE 494

  Fly  1480 MQEVVDAFNKDLLE----FNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNR 1540
            ::.:..::.   ||    :.|.:|||.:.|.:.|||||.....|.::||.||.||||.|...|.:
 Worm   495 IRAISLSYT---LENDKNYKLRVRIGFHAGPIAAGVIGIKNPRYCLFGDTVNFASRMQSNCPPLQ 556

  Fly  1541 IQVGKDCLPFL--TNRYEFEPRGSVYVKGKDHMEVFLYTTRRDNPLDDDEADKVEQLGT 1597
            ||..:.....|  |:.|:...||.|:||||..:..:..    :..:..||  ::|:.||
 Worm   557 IQTSEITARMLLATHEYKLVKRGIVHVKGKGEVNCYWL----NEHIHKDE--EIEESGT 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 59/244 (24%)
Guanylate_cyc 1388..1575 CDD:278633 57/192 (30%)
gcy-27NP_001255957.2 PKc_like 75..338 CDD:304357 42/224 (19%)
CYCc 383..573 CDD:214485 56/200 (28%)
Guanylate_cyc 411..595 CDD:278633 57/198 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.