DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-23

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:349 Identity:85/349 - (24%)
Similarity:154/349 - (44%) Gaps:76/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LIYTALPMPLWLGASTAISY----SIAFEMVSH-----------MVIGCSAIHGGPMHGGGGAAG 243
            :::.|||.|.....|..:.|    :..|....|           :::.|                
 Worm   738 ILFRALPFPNGTNVSEVMDYIRDGTKTFRPTVHDRTQIHPDLVALLLDC---------------- 786

  Fly   244 GSGMEANGDPSNRILILRIMAHLSVHLVGVHVLIMNLVRMRGTFMKVGQNLLVRR--QLEMEKQL 306
                 .|.:|..|..|.|:..:...:|.....|:..::||...:....:.|:..|  .||.....
 Worm   787 -----WNENPEVRPSIRRVRLNTENYLKVKGSLVDQMMRMMEQYANNLEKLVAERTGMLEEANVR 846

  Fly   307 KEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILF 371
            .:|::..::|..||                             |::| :.|.....:.:..:::|
 Worm   847 ADKLLGQLLPKYVA-----------------------------NELK-MGRSVPAKTFDMATVMF 881

  Fly   372 ADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRA-DHA-- 433
            :||||||.:.|:.|..::|.:||.::.:|||..:..|..|:.|:||.|..|||.||... :|.  
 Worm   882 SDIVGFTTICSSSTPLEVVSMLNSIYSKFDDAINKHGSYKVETIGDAYMIVSGIPEENGNEHIRN 946

  Fly   434 ICCVEMGLGMIDAMRCFDAQRHEGVKMRV--GVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMES 496
            ||...:.|.::  ::.::......||:|:  |:|||||..|:||....::.::.:.|::|::|||
 Worm   947 ICNTALELMLL--LKTYEIPHRRNVKLRIRLGIHTGTVAAGVVGLTAPRYCLFGDTVNVASRMES 1009

  Fly   497 SGKPEQVHISQETSSFLGDAYYLE 520
            :.:||::.:|||...|. ..||.|
 Worm  1010 TSEPEKIQMSQEARDFC-VRYYSE 1032

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 60/220 (27%)
Guanylate_cyc 361..535 CDD:278633 56/165 (34%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894 14/88 (16%)
HNOBA <817..863 CDD:285003 11/74 (15%)
CYCc 842..1035 CDD:214485 63/224 (28%)
Guanylate_cyc 869..1056 CDD:278633 56/167 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.