DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-21

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:309 Identity:86/309 - (27%)
Similarity:145/309 - (46%) Gaps:53/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DPSNRILILRIMAHLSVHLVGVHVLIM-NLVRMRGTFM-KVGQNLLVR-RQLEMEKQLKEKMIHS 313
            ||.||..:.:|...|....:|:...|| |:|.|...:. |:.:::..| .:||.||...|.::..
 Worm   864 DPLNRPSLHQIKRKLKPLTIGLKRTIMDNMVSMIEKYTDKLEKDIAERNEELEGEKAKSEALLKM 928

  Fly   314 VMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFT 378
            ::|..|||.|                       :..::|.:       .|.||.::.|:|..||.
 Worm   929 MLPEVVADSL-----------------------KLGSNVSA-------ESFENCTVFFSDCPGFV 963

  Fly   379 RMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLG 442
            .||:|.....:|:.||||:..||.:.......|:.|:.|.|...||.|.|..: ||.....:||.
 Worm   964 EMSATSKPIDIVQFLNDLYTVFDRIIDQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLA 1028

  Fly   443 MIDAMRCFDAQRH---EGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVH 504
            ::.|:..|.. ||   |.|::|:|:::|..:.|:||.:..::.::.:.|:.|::|||:|.|.:::
 Worm  1029 LLKAVESFKI-RHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRIN 1092

  Fly   505 ISQETSSFLGD--AYYLEE---------GEEVFGHRTYFVVGRRRDFTR 542
            .|......|..  .|.:||         |:::    ||||.|...|..|
 Worm  1093 CSGTAKEILDQLGGYEIEERGIVEMKGKGKQM----TYFVRGENSDMRR 1137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 59/221 (27%)
Guanylate_cyc 361..535 CDD:278633 58/188 (31%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822
PK_GC 612..881 CDD:270894 6/16 (38%)
HNOBA <890..938 CDD:400168 15/47 (32%)
Guanylate_cyc 944..1130 CDD:306677 59/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.