DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-15

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:309 Identity:86/309 - (27%)
Similarity:145/309 - (46%) Gaps:53/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DPSNRILILRIMAHLSVHLVGVHVLIM-NLVRMRGTFM-KVGQNLLVR-RQLEMEKQLKEKMIHS 313
            ||.||..:.:|...|....:|:...|| |:|.|...:. |:.:::..| .:||.||...|.::..
 Worm   805 DPLNRPSLHQIKRKLKPLTIGLKRTIMDNMVSMIEKYTDKLEKDIAERNEELEAEKAKSEALLKM 869

  Fly   314 VMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFT 378
            ::|..|||.|                       :..::|.:       .|.||.::.|:|..||.
 Worm   870 MLPEVVADSL-----------------------KLGSNVSA-------ESFENCTVFFSDCPGFV 904

  Fly   379 RMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLG 442
            .||:|.....:|:.||||:..||.:.......|:.|:.|.|...||.|.|..: ||.....:||.
 Worm   905 EMSATSKPIDIVQFLNDLYTVFDRIIDQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLA 969

  Fly   443 MIDAMRCFDAQRH---EGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVH 504
            ::.|:..|.. ||   |.|::|:|:::|..:.|:||.:..::.::.:.|:.|::|||:|.|.:::
 Worm   970 LLKAVESFKI-RHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRIN 1033

  Fly   505 ISQETSSFLGD--AYYLEE---------GEEVFGHRTYFVVGRRRDFTR 542
            .|......|..  .|.:||         |:::    ||||.|...|..|
 Worm  1034 CSGTAKEILDQLGGYEIEERGIVEMKGKGKQM----TYFVRGENSDMRR 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 59/221 (27%)
Guanylate_cyc 361..535 CDD:278633 58/188 (31%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822
PK_GC 553..822 CDD:270894 6/16 (38%)
HNOBA <831..879 CDD:400168 15/47 (32%)
Guanylate_cyc 885..1071 CDD:306677 59/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.