DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-13

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:236 Identity:76/236 - (32%)
Similarity:130/236 - (55%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1349 NAVANQDKV--RVQNM---KNQADMLLHNIIPKHVAEHLK-NTAKYSENHHNIAIIFASIVNFNE 1407
            :|.:.:|:|  |::.:   |.::|:||:.::|:.|||.|| ..:...|...::.|.|:.:|.|..
 Worm   791 HASSLEDEVQERMKELVEEKKKSDILLYRMLPQQVAERLKLGQSVEPEAFESVTIFFSDVVGFTV 855

  Fly  1408 MYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHT 1472
            :.::|  ...:.:.:||:|...||.::.:.:   ..|::|||..::..||| |...||  ||:..
 Worm   856 LANKS--TPLQVVNLLNDLYTTFDAIIEKND---SYKVETIGDAYLVVSGL-PRRNGT--EHVAN 912

  Fly  1473 LMEFSIAMQEVVDAFN-KDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG 1536
            :...|:.:.:.:.||. ..|.:..:.:||||:.|...|||:|.:...|.::||.||.||||:|.|
 Worm   913 IANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNG 977

  Fly  1537 LPNRIQVGKDCLPFLTN---RYEFEPRGSVYVKGKDHMEVF 1574
            .|..|.:..||...||:   .|..|.||.|.:|||..|:.:
 Worm   978 KPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTY 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 63/201 (31%)
Guanylate_cyc 1388..1575 CDD:278633 62/191 (32%)
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 11/31 (35%)
CYCc 808..1000 CDD:214485 63/199 (32%)
Guanylate_cyc 835..1022 CDD:278633 62/192 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.