DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-5

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:247 Identity:80/247 - (32%)
Similarity:125/247 - (50%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1363 KNQADMLLHNIIPKHVAEHLK--NTAKYSENHHNIAIIFASIVNFNEMYDESYLGGK----EFLR 1421
            |.:||:||..::||.|||.||  .|.: .|....:.::|:.:|.|.:      |..|    :.:.
 Worm   854 KKKADILLSRMLPKQVAERLKAGQTVE-PEGFDTVTVLFSDVVKFTQ------LAAKCSPFQVVN 911

  Fly  1422 VLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDA 1486
            :||:|..:||.::   |...|.|:::||..::..||| |:..|..  ||..:::.|:...:...:
 Worm   912 LLNDLYSNFDTII---EEHGVYKVESIGDGYLCVSGL-PTKNGYA--HIKQIVDMSLKFMDYCKS 970

  Fly  1487 FNKDLLEFNLI-LRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPF 1550
            |....|....: ||||:|.|...|||:|.|...|.::||.||.||||:|.|.|:.|.:.:.....
 Worm   971 FKVPHLPREKVELRIGINSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSL 1035

  Fly  1551 LT----NRYEFEPRGSVYVKGKDHMEVF-----------LYTTRRDNPLDDD 1587
            ||    ::||...||.|.:|||..||.|           ..:||...|:.|:
 Worm  1036 LTDHYPHQYETSSRGEVIIKGKGVMETFWVLGKTDSDTKSLSTRTTPPITDE 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 65/203 (32%)
Guanylate_cyc 1388..1575 CDD:278633 63/206 (31%)
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894
HNOBA <830..873 CDD:285003 10/18 (56%)
CYCc 852..1042 CDD:214485 65/200 (33%)
Guanylate_cyc 879..1067 CDD:278633 63/200 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.